Lineage for d1y2ob_ (1y2o B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015824Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2015825Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) (S)
    core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends
  5. 2015867Family a.238.1.3: IMD domain [140703] (1 protein)
    Pfam PF08397
  6. 2015868Protein BAP2/IRSp53 N-terminal domain [140704] (1 species)
  7. 2015869Species Human (Homo sapiens) [TaxId:9606] [140705] (3 PDB entries)
    Uniprot Q9UQB8 1-248! Uniprot Q9UQB8 2-228
  8. 2015871Domain d1y2ob_: 1y2o B: [122574]
    automated match to d1y2oa1

Details for d1y2ob_

PDB Entry: 1y2o (more details), 2.2 Å

PDB Description: Structure of N-terminal domain IRSp53/BAIAP2
PDB Compounds: (B:) BAI1-associated protein 2 isoform 1

SCOPe Domain Sequences for d1y2ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y2ob_ a.238.1.3 (B:) BAP2/IRSp53 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mslsrseemhrltenvyktimeqfnpslrnfiamgknyekalagvtyaakgyfdalvkmg
elasesqgskelgdvlfqmaevhrqiqnqleemlksfhnelltqleqkveldsrylsaal
kkyqteqrskgdaldkcqaelkklrkksqgsknpqkysdkelqyidaisnkqgelenyvs
dgyktalteerrrfcflvekqcavaknsaayhskgkellaqklplwqqacadpskipera
vqlmqqva

SCOPe Domain Coordinates for d1y2ob_:

Click to download the PDB-style file with coordinates for d1y2ob_.
(The format of our PDB-style files is described here.)

Timeline for d1y2ob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1y2oa1