PDB entry 1y2o

View 1y2o on RCSB PDB site
Description: Structure of N-terminal domain IRSp53/BAIAP2
Class: signaling protein
Keywords: cell motility, filopodia, actin bundling, SIGNALING PROTEIN
Deposited on 2004-11-23, released 2005-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.23
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BAI1-associated protein 2 isoform 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UQB8 (0-End)
      • modified residue (0)
      • modified residue (8)
      • modified residue (20)
      • modified residue (33)
      • modified residue (58)
      • modified residue (78)
      • modified residue (92)
      • modified residue (243)
    Domains in SCOPe 2.07: d1y2oa1
  • Chain 'B':
    Compound: BAI1-associated protein 2 isoform 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UQB8 (0-End)
      • modified residue (0)
      • modified residue (8)
      • modified residue (20)
      • modified residue (33)
      • modified residue (58)
      • modified residue (78)
      • modified residue (92)
      • modified residue (243)
    Domains in SCOPe 2.07: d1y2ob_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y2oA (A:)
    mslsrseemhrltenvyktimeqfnpslrnfiamgknyekalagvtyaakgyfdalvkmg
    elasesqgskelgdvlfqmaevhrqiqnqleemlksfhnelltqleqkveldsrylsaal
    kkyqteqrskgdaldkcqaelkklrkksqgsknpqkysdkelqyidaisnkqgelenyvs
    dgyktalteerrrfcflvekqcavaknsaayhskgkellaqklplwqqacadpskipera
    vqlmqqvasn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y2oA (A:)
    mslsrseemhrltenvyktimeqfnpslrnfiamgknyekalagvtyaakgyfdalvkmg
    elasesqgskelgdvlfqmaevhrqiqnqleemlksfhnelltqleqkveldsrylsaal
    kkyqteqrskgdaldkcqaelkklrkksqgsknpqkysdkelqyidaisnkqgelenyvs
    dgyktalteerrrfcflvekqcavaknsaayhskgkellaqklplwqqacadpskipera
    vqlmqqva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y2oB (B:)
    mslsrseemhrltenvyktimeqfnpslrnfiamgknyekalagvtyaakgyfdalvkmg
    elasesqgskelgdvlfqmaevhrqiqnqleemlksfhnelltqleqkveldsrylsaal
    kkyqteqrskgdaldkcqaelkklrkksqgsknpqkysdkelqyidaisnkqgelenyvs
    dgyktalteerrrfcflvekqcavaknsaayhskgkellaqklplwqqacadpskipera
    vqlmqqvasn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y2oB (B:)
    mslsrseemhrltenvyktimeqfnpslrnfiamgknyekalagvtyaakgyfdalvkmg
    elasesqgskelgdvlfqmaevhrqiqnqleemlksfhnelltqleqkveldsrylsaal
    kkyqteqrskgdaldkcqaelkklrkksqgsknpqkysdkelqyidaisnkqgelenyvs
    dgyktalteerrrfcflvekqcavaknsaayhskgkellaqklplwqqacadpskipera
    vqlmqqva