SCOPe 2.07: Domain d1y1mb_: 1y1m B:

Lineage for d1y1mb_ (1y1m B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein N-methyl-D-aspartate receptor subunit 1 [89787] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [89788] (33 PDB entries)

8. Domain d1y1mb_: 1y1m B: [122549]
   automated match to d1pb7a_
   complexed with ac5

Details for d1y1mb_

PDB Entry: 1y1m, 1.8 Å

PDB Description: crystal structure of the nr1 ligand binding core in complex with cycloleucine

PDB Compounds: (B:) Glutamate [NMDA] receptor subunit zeta 1

SCOPe Domain Sequences for d1y1mb_:

Sequence, based on SEQRES records:

>d1y1mb_ c.94.1.1 (B:) N-methyl-D-aspartate receptor subunit 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgpndtspgsprhtvpqccy
gfcidlliklartmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadmivap
ltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdiy
frrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgel
ffrsgfgigmrkdspwkqnvslsilkshengfmedldktwv

Sequence, based on observed residues (ATOM records):

>d1y1mb_ c.94.1.1 (B:) N-methyl-D-aspartate receptor subunit 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgptvpqccygfcidllikl
artmnftyevhlvadgkfgtqekewngmmgellsgqadmivapltinneraqyiefskpf
kyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdiyfrrqvelstmyrhmekh
nyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgelffrsgfgigmrkdspwk
qnvslsilkshengfmedldktwv

Timeline for d1y1mb_:

• d1y1mb_ first appeared in SCOP 1.73, called d1y1mb1
  
• d1y1mb_ appears in SCOPe 2.06
  
• d1y1mb_ appears in the current release, SCOPe 2.08