![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (35 proteins) |
![]() | Protein N-methyl-D-aspartate receptor subunit 1 [89787] (2 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [89788] (8 PDB entries) |
![]() | Domain d1y1mb1: 1y1m B:5-285 [122549] automatically matched to d1pb7a_ complexed with ac5 |
PDB Entry: 1y1m (more details), 1.8 Å
SCOP Domain Sequences for d1y1mb1:
Sequence, based on SEQRES records: (download)
>d1y1mb1 c.94.1.1 (B:5-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]} rlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgpndtspgsprhtvpqccy gfcidlliklartmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadmivap ltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdiy frrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgel ffrsgfgigmrkdspwkqnvslsilkshengfmedldktwv
>d1y1mb1 c.94.1.1 (B:5-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]} rlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgptvpqccygfcidllikl artmnftyevhlvadgkfgtqekewngmmgellsgqadmivapltinneraqyiefskpf kyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdiyfrrqvelstmyrhmekh nyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgelffrsgfgigmrkdspwk qnvslsilkshengfmedldktwv
Timeline for d1y1mb1: