Lineage for d1y1mb1 (1y1m B:5-285)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710610Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 710611Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 710612Family c.94.1.1: Phosphate binding protein-like [53851] (35 proteins)
  6. 711002Protein N-methyl-D-aspartate receptor subunit 1 [89787] (2 species)
  7. 711003Species Rat (Rattus norvegicus) [TaxId:10116] [89788] (8 PDB entries)
  8. 711010Domain d1y1mb1: 1y1m B:5-285 [122549]
    automatically matched to d1pb7a_
    complexed with ac5

Details for d1y1mb1

PDB Entry: 1y1m (more details), 1.8 Å

PDB Description: crystal structure of the nr1 ligand binding core in complex with cycloleucine
PDB Compounds: (B:) Glutamate [NMDA] receptor subunit zeta 1

SCOP Domain Sequences for d1y1mb1:

Sequence, based on SEQRES records: (download)

>d1y1mb1 c.94.1.1 (B:5-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]}
rlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgpndtspgsprhtvpqccy
gfcidlliklartmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadmivap
ltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdiy
frrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgel
ffrsgfgigmrkdspwkqnvslsilkshengfmedldktwv

Sequence, based on observed residues (ATOM records): (download)

>d1y1mb1 c.94.1.1 (B:5-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]}
rlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgptvpqccygfcidllikl
artmnftyevhlvadgkfgtqekewngmmgellsgqadmivapltinneraqyiefskpf
kyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdiyfrrqvelstmyrhmekh
nyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgelffrsgfgigmrkdspwk
qnvslsilkshengfmedldktwv

SCOP Domain Coordinates for d1y1mb1:

Click to download the PDB-style file with coordinates for d1y1mb1.
(The format of our PDB-style files is described here.)

Timeline for d1y1mb1: