Lineage for d1y0ja_ (1y0j A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3035588Family g.39.1.1: Erythroid transcription factor GATA-1 [57717] (2 proteins)
    single zinc-binding motif
  6. 3035589Protein Erythroid transcription factor GATA-1 [57718] (3 species)
  7. 3035600Species Mouse (Mus musculus) [TaxId:10090] [57720] (2 PDB entries)
  8. 3035601Domain d1y0ja_: 1y0j A: [122483]
    Other proteins in same PDB: d1y0jb2, d1y0jb3
    automated match to d1gnfa_
    protein/DNA complex; complexed with zn

Details for d1y0ja_

PDB Entry: 1y0j (more details)

PDB Description: zinc fingers as protein recognition motifs: structural basis for the gata-1/friend of gata interaction
PDB Compounds: (A:) Erythroid transcription factor

SCOPe Domain Sequences for d1y0ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y0ja_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]}
earecvncgatatplwrrdrtghylcnacglyhkmngqn

SCOPe Domain Coordinates for d1y0ja_:

Click to download the PDB-style file with coordinates for d1y0ja_.
(The format of our PDB-style files is described here.)

Timeline for d1y0ja_: