SCOPe 2.08: Domain d1y0jb2: 1y0j B:3-36

Lineage for d1y0jb2 (1y0j B:3-36)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
   simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC

4. Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families)

5. Family g.37.1.2: C2HC finger [57697] (3 proteins)

6. Protein U-shaped transcription factor, different fingers [57698] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [57699] (4 PDB entries)

8. Domain d1y0jb2: 1y0j B:3-36 [122484]
   Other proteins in same PDB: d1y0ja_, d1y0jb3
   automated match to d1y0jb1
   protein/DNA complex; complexed with zn

Details for d1y0jb2

PDB Entry: 1y0j

PDB Description: zinc fingers as protein recognition motifs: structural basis for the gata-1/friend of gata interaction

PDB Compounds: (B:) Zinc-finger protein ush

SCOPe Domain Sequences for d1y0jb2:

Sequence; same for both SEQRES and ATOM records:

>d1y0jb2 g.37.1.2 (B:3-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
llkparfmclpcgiafsspstleahqayycshri

Timeline for d1y0jb2:

• d1y0jb2 first appeared in SCOP 1.73, called d1y0jb1
  
• d1y0jb2 appears in SCOPe 2.07