SCOPe 2.05: Domain d1xxwa_: 1xxw A:

Lineage for d1xxwa_ (1xxw A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Snake phospholipase A2 [48624] (36 species)

7. Species Andaman cobra (Naja sagittifera), isoform 2 [TaxId:195058] [89169] (4 PDB entries)
   heterodimer of two different isoforms

8. Domain d1xxwa_: 1xxw A: [122431]
   automated match to d1s6ba_
   complexed with acy, zn

Details for d1xxwa_

PDB Entry: 1xxw, 2.7 Å

PDB Description: Structure of zinc induced heterodimer of two calcium free isoforms of phospholipase A2 from Naja naja sagittifera at 2.7A resolution

PDB Compounds: (A:) Phospholipase A2 isoform 1

SCOPe Domain Sequences for d1xxwa_:

Sequence; same for both SEQRES and ATOM records:

>d1xxwa_ a.133.1.2 (A:) Snake phospholipase A2 {Andaman cobra (Naja sagittifera), isoform 2 [TaxId: 195058]}
ntyqfknmiqctvpkrswwdfadygcycgrggsgtpiddldrccqvhdncynsareqggc
rpkqktysyeckagtlscsgsnnscaatvcdcdrlaaicfagapyndnnynidlkarcq

Timeline for d1xxwa_:

• d1xxwa_ first appeared in SCOP 1.73, called d1xxwa1
  
• d1xxwa_ appears in SCOPe 2.04
  
• d1xxwa_ appears in SCOPe 2.06
  
• d1xxwa_ appears in the current release, SCOPe 2.08