Lineage for d1xxwa_ (1xxw A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011697Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2011698Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2011703Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 protein domains)
    automatically mapped to Pfam PF00068
  6. 2011813Protein Snake phospholipase A2 [48624] (37 species)
  7. 2011819Species Andaman cobra (Naja sagittifera), isoform 2 [TaxId:195058] [89169] (4 PDB entries)
    heterodimer of two different isoforms
  8. 2011821Domain d1xxwa_: 1xxw A: [122431]
    automated match to d1s6ba_
    complexed with acy, zn

Details for d1xxwa_

PDB Entry: 1xxw (more details), 2.7 Å

PDB Description: Structure of zinc induced heterodimer of two calcium free isoforms of phospholipase A2 from Naja naja sagittifera at 2.7A resolution
PDB Compounds: (A:) Phospholipase A2 isoform 1

SCOPe Domain Sequences for d1xxwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxwa_ a.133.1.2 (A:) Snake phospholipase A2 {Andaman cobra (Naja sagittifera), isoform 2 [TaxId: 195058]}
ntyqfknmiqctvpkrswwdfadygcycgrggsgtpiddldrccqvhdncynsareqggc
rpkqktysyeckagtlscsgsnnscaatvcdcdrlaaicfagapyndnnynidlkarcq

SCOPe Domain Coordinates for d1xxwa_:

Click to download the PDB-style file with coordinates for d1xxwa_.
(The format of our PDB-style files is described here.)

Timeline for d1xxwa_: