SCOP 1.73: Domain d1xxwa1: 1xxw A:1-120

Lineage for d1xxwa1 (1xxw A:1-120)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Snake phospholipase A2 [48624] (35 species)

7. Species Indian cobra (Naja naja) [TaxId:35670] [48626] (4 PDB entries)

8. Domain d1xxwa1: 1xxw A:1-120 [122431]
   automatically matched to d1a3d__
   complexed with acy, zn

Details for d1xxwa1

PDB Entry: 1xxw, 2.7 Å

PDB Description: Structure of zinc induced heterodimer of two calcium free isoforms of phospholipase A2 from Naja naja sagittifera at 2.7A resolution

PDB Compounds: (A:) Phospholipase A2 isoform 1

SCOP Domain Sequences for d1xxwa1:

Sequence; same for both SEQRES and ATOM records:

>d1xxwa1 a.133.1.2 (A:1-120) Snake phospholipase A2 {Indian cobra (Naja naja) [TaxId: 35670]}
ntyqfknmiqctvpkrswwdfadygcycgrggsgtpiddldrccqvhdncynsareqggc
rpkqktysyeckagtlscsgsnnscaatvcdcdrlaaicfagapyndnnynidlkarcq

Timeline for d1xxwa1:

• d1xxwa1 is new in SCOP 1.73
  
• d1xxwa1 appears in SCOP 1.75
  
• d1xxwa1 appears in the current release, SCOPe 2.08, called d1xxwa_