Lineage for d1xwna1 (1xwn A:1-166)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2806645Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2806646Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2806647Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2806979Protein Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 [141517] (1 species)
  7. 2806980Species Human (Homo sapiens) [TaxId:9606] [141518] (4 PDB entries)
    Uniprot Q9Y3C6 1-166
  8. 2806984Domain d1xwna1: 1xwn A:1-166 [122404]

Details for d1xwna1

PDB Entry: 1xwn (more details)

PDB Description: solution structure of cyclophilin like 1(ppil1) and insights into its interaction with skip
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase like 1

SCOPe Domain Sequences for d1xwna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]}
maaippdswqppnvyletsmgiivlelywkhapktcknfaelarrgyyngtkfhriikdf
miqggdptgtgrggasiygkqfedelhpdlkftgagilamanagpdtngsqffvtlaptq
wldgkhtifgrvcqgigmvnrvgmvetnsqdrpvddvkiikaypsg

SCOPe Domain Coordinates for d1xwna1:

Click to download the PDB-style file with coordinates for d1xwna1.
(The format of our PDB-style files is described here.)

Timeline for d1xwna1: