![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
![]() | Superfamily b.62.1: Cyclophilin-like [50891] (5 families) ![]() |
![]() | Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
![]() | Protein Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 [141517] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141518] (4 PDB entries) Uniprot Q9Y3C6 1-166 |
![]() | Domain d1xwna1: 1xwn A:1-166 [122404] |
PDB Entry: 1xwn (more details)
SCOPe Domain Sequences for d1xwna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} maaippdswqppnvyletsmgiivlelywkhapktcknfaelarrgyyngtkfhriikdf miqggdptgtgrggasiygkqfedelhpdlkftgagilamanagpdtngsqffvtlaptq wldgkhtifgrvcqgigmvnrvgmvetnsqdrpvddvkiikaypsg
Timeline for d1xwna1: