Lineage for d1xwna1 (1xwn A:1-166)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674493Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 674494Superfamily b.62.1: Cyclophilin-like [50891] (3 families) (S)
  5. 674495Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 proteins)
  6. 674685Protein Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 [141517] (1 species)
  7. 674686Species Human (Homo sapiens) [TaxId:9606] [141518] (1 PDB entry)
  8. 674687Domain d1xwna1: 1xwn A:1-166 [122404]

Details for d1xwna1

PDB Entry: 1xwn (more details)

PDB Description: solution structure of cyclophilin like 1(PPIL1) and insights into its interaction with SKIP
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase like 1

SCOP Domain Sequences for d1xwna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]}
maaippdswqppnvyletsmgiivlelywkhapktcknfaelarrgyyngtkfhriikdf
miqggdptgtgrggasiygkqfedelhpdlkftgagilamanagpdtngsqffvtlaptq
wldgkhtifgrvcqgigmvnrvgmvetnsqdrpvddvkiikaypsg

SCOP Domain Coordinates for d1xwna1:

Click to download the PDB-style file with coordinates for d1xwna1.
(The format of our PDB-style files is described here.)

Timeline for d1xwna1: