PDB entry 1xwn

View 1xwn on RCSB PDB site
Description: solution structure of cyclophilin like 1(PPIL1) and insights into its interaction with SKIP
Class: isomerase
Keywords: beta barrel, isomerase
Deposited on 2004-11-01, released 2005-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase like 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PPIL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xwna1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xwnA (A:)
    maaippdswqppnvyletsmgiivlelywkhapktcknfaelarrgyyngtkfhriikdf
    miqggdptgtgrggasiygkqfedelhpdlkftgagilamanagpdtngsqffvtlaptq
    wldgkhtifgrvcqgigmvnrvgmvetnsqdrpvddvkiikaypsglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xwnA (A:)
    maaippdswqppnvyletsmgiivlelywkhapktcknfaelarrgyyngtkfhriikdf
    miqggdptgtgrggasiygkqfedelhpdlkftgagilamanagpdtngsqffvtlaptq
    wldgkhtifgrvcqgigmvnrvgmvetnsqdrpvddvkiikaypsg