Class a: All alpha proteins [46456] (284 folds) |
Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies) core: 3 helices; bundle, open |
Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) duplication: consists of two domains of this fold |
Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein) |
Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species) |
Species Methylococcus capsulatus [TaxId:414] [47155] (27 PDB entries) |
Domain d1xu3e_: 1xu3 E: [122324] Other proteins in same PDB: d1xu3a1, d1xu3b1, d1xu3c_, d1xu3d_ automated match to d1fyzf_ complexed with bml, fe |
PDB Entry: 1xu3 (more details), 2.3 Å
SCOPe Domain Sequences for d1xu3e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xu3e_ a.23.3.1 (E:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]} klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs
Timeline for d1xu3e_: