Lineage for d1xu3e_ (1xu3 E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699273Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 2699320Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
    duplication: consists of two domains of this fold
    automatically mapped to Pfam PF02964
  5. 2699321Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (2 proteins)
  6. 2699322Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 2699323Species Methylococcus capsulatus [TaxId:414] [47155] (27 PDB entries)
  8. 2699358Domain d1xu3e_: 1xu3 E: [122324]
    Other proteins in same PDB: d1xu3a_, d1xu3b_, d1xu3c_, d1xu3d_
    automated match to d1fyzf_
    complexed with bml, fe

Details for d1xu3e_

PDB Entry: 1xu3 (more details), 2.3 Å

PDB Description: Soluble methane monooxygenase hydroxylase-soaked with bromophenol
PDB Compounds: (E:) Methane monooxygenase component A gamma chain

SCOPe Domain Sequences for d1xu3e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xu3e_ a.23.3.1 (E:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs

SCOPe Domain Coordinates for d1xu3e_:

Click to download the PDB-style file with coordinates for d1xu3e_.
(The format of our PDB-style files is described here.)

Timeline for d1xu3e_: