Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species) |
Species Methylococcus capsulatus [TaxId:414] [88793] (27 PDB entries) |
Domain d1xu3d_: 1xu3 D: [122323] Other proteins in same PDB: d1xu3a1, d1xu3b1, d1xu3e_, d1xu3f_ automated match to d1fyzc_ complexed with bml, fe |
PDB Entry: 1xu3 (more details), 2.3 Å
SCOPe Domain Sequences for d1xu3d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xu3d_ a.25.1.2 (D:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]} smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd dwiedyasridfkadrdqivkavlaglk
Timeline for d1xu3d_: