Lineage for d1xrxd_ (1xrx D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735385Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 1735386Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 1735538Family a.43.1.7: SeqA N-terminal domain-like [140547] (1 protein)
    N-terminal part of Pfam PF03925
  6. 1735539Protein SeqA [140548] (1 species)
    a negative modulator of replication initiation
  7. 1735540Species Escherichia coli [TaxId:562] [140549] (1 PDB entry)
    Uniprot P0AFY8 1-35
  8. 1735544Domain d1xrxd_: 1xrx D: [122267]
    automated match to d1xrxa1
    complexed with ca

Details for d1xrxd_

PDB Entry: 1xrx (more details), 2.15 Å

PDB Description: Crystal structure of a DNA-binding protein
PDB Compounds: (D:) SeqA protein

SCOPe Domain Sequences for d1xrxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xrxd_ a.43.1.7 (D:) SeqA {Escherichia coli [TaxId: 562]}
mktievddelysyiashtkhigesasdilrrmlkf

SCOPe Domain Coordinates for d1xrxd_:

Click to download the PDB-style file with coordinates for d1xrxd_.
(The format of our PDB-style files is described here.)

Timeline for d1xrxd_: