Lineage for d1xrxd1 (1xrx D:1-35)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 641597Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 641598Superfamily a.43.1: Ribbon-helix-helix [47598] (8 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 641746Family a.43.1.7: SeqA N-terminal domain-like [140547] (1 protein)
    N-terminal part of Pfam PF03925
  6. 641747Protein SeqA [140548] (1 species)
    a negative modulator of replication initiation
  7. 641748Species Escherichia coli [TaxId:562] [140549] (1 PDB entry)
  8. 641752Domain d1xrxd1: 1xrx D:1-35 [122267]
    automatically matched to 1XRX A:1-35
    complexed with ca

Details for d1xrxd1

PDB Entry: 1xrx (more details), 2.15 Å

PDB Description: Crystal structure of a DNA-binding protein
PDB Compounds: (D:) SeqA protein

SCOP Domain Sequences for d1xrxd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xrxd1 a.43.1.7 (D:1-35) SeqA {Escherichia coli [TaxId: 562]}
mktievddelysyiashtkhigesasdilrrmlkf

SCOP Domain Coordinates for d1xrxd1:

Click to download the PDB-style file with coordinates for d1xrxd1.
(The format of our PDB-style files is described here.)

Timeline for d1xrxd1: