![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) ![]() formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
![]() | Family a.43.1.7: SeqA N-terminal domain-like [140547] (1 protein) N-terminal part of Pfam PF03925 |
![]() | Protein SeqA [140548] (1 species) a negative modulator of replication initiation |
![]() | Species Escherichia coli [TaxId:562] [140549] (1 PDB entry) Uniprot P0AFY8 1-35 |
![]() | Domain d1xrxd_: 1xrx D: [122267] automated match to d1xrxa1 complexed with ca |
PDB Entry: 1xrx (more details), 2.15 Å
SCOPe Domain Sequences for d1xrxd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xrxd_ a.43.1.7 (D:) SeqA {Escherichia coli [TaxId: 562]} mktievddelysyiashtkhigesasdilrrmlkf
Timeline for d1xrxd_: