PDB entry 1xrx

View 1xrx on RCSB PDB site
Description: Crystal structure of a DNA-binding protein
Class: replication inhibitor
Keywords: Protein filament, Left-handed helix, DNA replication inhibitor, REPLICATION INHIBITOR
Deposited on 2004-10-16, released 2005-05-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.222
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SeqA protein
    Species: Escherichia coli [TaxId:562]
    Gene: SeqA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36658 (0-End)
      • modified residue (0)
      • modified residue (31)
    Domains in SCOPe 2.07: d1xrxa1
  • Chain 'B':
    Compound: SeqA protein
    Species: Escherichia coli [TaxId:562]
    Gene: SeqA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36658 (0-End)
      • modified residue (0)
      • modified residue (31)
    Domains in SCOPe 2.07: d1xrxb_
  • Chain 'C':
    Compound: SeqA protein
    Species: Escherichia coli [TaxId:562]
    Gene: SeqA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36658 (0-End)
      • modified residue (0)
      • modified residue (31)
    Domains in SCOPe 2.07: d1xrxc_
  • Chain 'D':
    Compound: SeqA protein
    Species: Escherichia coli [TaxId:562]
    Gene: SeqA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36658 (0-End)
      • modified residue (0)
      • modified residue (31)
    Domains in SCOPe 2.07: d1xrxd_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xrxA (A:)
    mktievddelysyiashtkhigesasdilrrmlkfsaasqpaapvtkevr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xrxA (A:)
    mktievddelysyiashtkhigesasdilrrmlkf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xrxB (B:)
    mktievddelysyiashtkhigesasdilrrmlkfsaasqpaapvtkevr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xrxB (B:)
    mktievddelysyiashtkhigesasdilrrmlkf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xrxC (C:)
    mktievddelysyiashtkhigesasdilrrmlkfsaasqpaapvtkevr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xrxC (C:)
    mktievddelysyiashtkhigesasdilrrmlkf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xrxD (D:)
    mktievddelysyiashtkhigesasdilrrmlkfsaasqpaapvtkevr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xrxD (D:)
    mktievddelysyiashtkhigesasdilrrmlkf