| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.43.1: Ribbon-helix-helix [47598] (8 families) ![]() formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
| Family a.43.1.7: SeqA N-terminal domain-like [140547] (1 protein) N-terminal part of Pfam PF03925 |
| Protein SeqA [140548] (1 species) a negative modulator of replication initiation |
| Species Escherichia coli [TaxId:562] [140549] (1 PDB entry) |
| Domain d1xrxa1: 1xrx A:1-35 [122264] complexed with ca |
PDB Entry: 1xrx (more details), 2.15 Å
SCOP Domain Sequences for d1xrxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xrxa1 a.43.1.7 (A:1-35) SeqA {Escherichia coli [TaxId: 562]}
mktievddelysyiashtkhigesasdilrrmlkf
Timeline for d1xrxa1: