Lineage for d1xqsb1 (1xqs B:87-350)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006840Family a.118.1.21: HspBP1 domain [140822] (1 protein)
  6. 2006841Protein Hsp70-binding protein 1 (HspBP1) [140823] (1 species)
  7. 2006842Species Human (Homo sapiens) [TaxId:9606] [140824] (2 PDB entries)
    Uniprot Q9NZL4 87-350
  8. 2006846Domain d1xqsb1: 1xqs B:87-350 [122244]
    automatically matched to 1XQR A:87-350
    complexed with amp

Details for d1xqsb1

PDB Entry: 1xqs (more details), 2.9 Å

PDB Description: Crystal structure of the HspBP1 core domain complexed with the fragment of Hsp70 ATPase domain
PDB Compounds: (B:) HSPBP1 protein

SCOPe Domain Sequences for d1xqsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xqsb1 a.118.1.21 (B:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]}
rgeveqmksclrvlsqpmpptageaeqaadqqeregalelladlcenmdnaadfcqlsgm
hllvgryleagaaglrwraaqligtcsqnvaaiqeqvlglgalrkllrlldrdacdtvrv
kalfaisclvreqeagllqflrldgfsvlmramqqqvqklkvksafllqnllvghpehkg
tlcsmgmvqqlvalvrtehspfhehvlgalcslvtdfpqgvrecrepelgleellrhrcq
llqqheeyqeelefcekllqtcfs

SCOPe Domain Coordinates for d1xqsb1:

Click to download the PDB-style file with coordinates for d1xqsb1.
(The format of our PDB-style files is described here.)

Timeline for d1xqsb1: