SCOP 1.73: Domain d1xqsb1: 1xqs B:87-350

Lineage for d1xqsb1 (1xqs B:87-350)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (22 families)

5. Family a.118.1.21: HspBP1 domain [140822] (1 protein)
   this is a repeat family; one repeat unit is 1xqr A:200-242 found in domain

6. Protein Hsp70-binding protein 1 (HspBP1) [140823] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140824] (2 PDB entries)

8. Domain d1xqsb1: 1xqs B:87-350 [122244]
   automatically matched to 1XQR A:87-350
   complexed with amp; mutant

Details for d1xqsb1

PDB Entry: 1xqs, 2.9 Å

PDB Description: crystal structure of the hspbp1 core domain complexed with the fragment of hsp70 atpase domain

PDB Compounds: (B:) HSPBP1 protein

SCOP Domain Sequences for d1xqsb1:

Sequence; same for both SEQRES and ATOM records:

>d1xqsb1 a.118.1.21 (B:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]}
rgeveqmksclrvlsqpmpptageaeqaadqqeregalelladlcenmdnaadfcqlsgm
hllvgryleagaaglrwraaqligtcsqnvaaiqeqvlglgalrkllrlldrdacdtvrv
kalfaisclvreqeagllqflrldgfsvlmramqqqvqklkvksafllqnllvghpehkg
tlcsmgmvqqlvalvrtehspfhehvlgalcslvtdfpqgvrecrepelgleellrhrcq
llqqheeyqeelefcekllqtcfs

Timeline for d1xqsb1:

• d1xqsb1 is new in SCOP 1.73
  
• d1xqsb1 appears in SCOP 1.75
  
• d1xqsb1 appears in the current release, SCOPe 2.08