Class b: All beta proteins [48724] (174 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
Protein automated matches [190052] (3 species) not a true protein |
Species Western clawed frog (Xenopus tropicalis) [TaxId:8364] [186773] (2 PDB entries) |
Domain d1xodb_: 1xod B: [122203] Other proteins in same PDB: d1xoda1 automated match to d1evha_ complexed with gol |
PDB Entry: 1xod (more details), 1.15 Å
SCOPe Domain Sequences for d1xodb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xodb_ b.55.1.0 (B:) automated matches {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]} gsddsyarvravvmtrddssggwlqlgggglssvtvsktlqpgdsggteflvhgerlrdk tvvlecvlrrdlvynkvtptfhhwrigdkkfgltfqspadarafdrgirraiedlsqg
Timeline for d1xodb_: