SCOP 1.73: Domain d1xodb1: 1xod B:10-123

Lineage for d1xodb1 (1xod B:10-123)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (12 families)

5. Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (6 proteins)

6. Protein Sprouty-related, EVH1 domain-containing protein 1, Spred-1 [141430] (1 species)

7. Species Western clawed frog (Xenopus tropicalis) [TaxId:8364] [141431] (2 PDB entries)

8. Domain d1xodb1: 1xod B:10-123 [122203]
   automatically matched to 1XOD A:10-123
   complexed with gol

Details for d1xodb1

PDB Entry: 1xod, 1.15 Å

PDB Description: Crystal structure of X. tropicalis Spred1 EVH-1 domain

PDB Compounds: (B:) Spred1

SCOP Domain Sequences for d1xodb1:

Sequence; same for both SEQRES and ATOM records:

>d1xodb1 b.55.1.4 (B:10-123) Sprouty-related, EVH1 domain-containing protein 1, Spred-1 {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]}
syarvravvmtrddssggwlqlgggglssvtvsktlqpgdsggteflvhgerlrdktvvl
ecvlrrdlvynkvtptfhhwrigdkkfgltfqspadarafdrgirraiedlsqg

Timeline for d1xodb1:

• d1xodb1 is new in SCOP 1.73
  
• d1xodb1 appears in SCOP 1.75
  
• d1xodb1 appears in the current release, SCOPe 2.08, called d1xodb2