Lineage for d1xodb2 (1xod B:8-123)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803713Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2803714Protein automated matches [190052] (8 species)
    not a true protein
  7. 2803961Species Western clawed frog (Xenopus tropicalis) [TaxId:8364] [186773] (2 PDB entries)
  8. 2803962Domain d1xodb2: 1xod B:8-123 [122203]
    Other proteins in same PDB: d1xoda1, d1xodb3
    automated match to d1evha_
    complexed with gol

Details for d1xodb2

PDB Entry: 1xod (more details), 1.15 Å

PDB Description: Crystal structure of X. tropicalis Spred1 EVH-1 domain
PDB Compounds: (B:) Spred1

SCOPe Domain Sequences for d1xodb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xodb2 b.55.1.0 (B:8-123) automated matches {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]}
ddsyarvravvmtrddssggwlqlgggglssvtvsktlqpgdsggteflvhgerlrdktv
vlecvlrrdlvynkvtptfhhwrigdkkfgltfqspadarafdrgirraiedlsqg

SCOPe Domain Coordinates for d1xodb2:

Click to download the PDB-style file with coordinates for d1xodb2.
(The format of our PDB-style files is described here.)

Timeline for d1xodb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xodb3
View in 3D
Domains from other chains:
(mouse over for more information)
d1xoda1