Lineage for d1xoca1 (1xoc A:17-520)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914521Protein Oligo-peptide binding protein (OPPA) [53852] (3 species)
    contains an additional alpha+beta domain inserted in the N-terminal domain
  7. 2914522Species Bacillus subtilis [TaxId:1423] [142799] (1 PDB entry)
    Uniprot P42061 40-543
  8. 2914523Domain d1xoca1: 1xoc A:17-520 [122201]
    complexed with zn
    has additional subdomain(s) that are not in the common domain

Details for d1xoca1

PDB Entry: 1xoc (more details), 1.55 Å

PDB Description: The structure of the oligopeptide-binding protein, AppA, from Bacillus subtilis in complex with a nonapeptide.
PDB Compounds: (A:) Oligopeptide-binding protein appA

SCOPe Domain Sequences for d1xoca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xoca1 c.94.1.1 (A:17-520) Oligo-peptide binding protein (OPPA) {Bacillus subtilis [TaxId: 1423]}
kpqqggdlvvgsigeptlfnslystddastdienmlysfltktdeklnvklslaesikel
dgglaydvkikkgvkfhdgkeltaddvvftysvplskdykgergstyemlksvekkgdye
vlfklkykdgnfynnaldstailpkhilgnvpiadleenefnrkkpigsgpfkfkewkqg
qyikleanddyfegrpyldtvtykvipdanaaeaqlqagdinffnvpatdyktaekfnnl
kivtdlalsyvyigwneknelfkdkkvrqalttaldresivsqvldgdgevayipespls
wnypkdidvpkfeynekkakqmlaeagwkdtngdgildkdgkkfsftlktnqgnkvredi
avvvqeqlkkigievktqivewsalveqmnppnwdfdamvmgwslstfpdqydifhssqi
kkglnyvwyknaeadklmkdaksisdrkqyskeyeqiyqkiaedqpytflyypnnhmamp
enlegykyhpkrdlyniekwwlak

SCOPe Domain Coordinates for d1xoca1:

Click to download the PDB-style file with coordinates for d1xoca1.
(The format of our PDB-style files is described here.)

Timeline for d1xoca1: