PDB entry 1xoc

View 1xoc on RCSB PDB site
Description: The structure of the oligopeptide-binding protein, AppA, from Bacillus subtilis in complex with a nonapeptide.
Class: transport protein
Keywords: oligopeptide, AppA, transport, Bacillus subtilis, TRANSPORT PROTEIN
Deposited on 2004-10-06, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-10, with a file datestamp of 2014-09-05.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.177
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oligopeptide-binding protein appA
    Species: Bacillus subtilis [TaxId:1423]
    Gene: appA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xoca1
  • Chain 'B':
    Compound: Nonapeptide VDSKNTSSW
    Database cross-references and differences (RAF-indexed):
    • PDB 1XOC (0-8)
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xocA (A:)
    ssgskssnssakksagkpqqggdlvvgsigeptlfnslystddastdienmlysfltktd
    eklnvklslaesikeldgglaydvkikkgvkfhdgkeltaddvvftysvplskdykgerg
    styemlksvekkgdyevlfklkykdgnfynnaldstailpkhilgnvpiadleenefnrk
    kpigsgpfkfkewkqgqyikleanddyfegrpyldtvtykvipdanaaeaqlqagdinff
    nvpatdyktaekfnnlkivtdlalsyvyigwneknelfkdkkvrqalttaldresivsqv
    ldgdgevayipesplswnypkdidvpkfeynekkakqmlaeagwkdtngdgildkdgkkf
    sftlktnqgnkvrediavvvqeqlkkigievktqivewsalveqmnppnwdfdamvmgws
    lstfpdqydifhssqikkglnyvwyknaeadklmkdaksisdrkqyskeyeqiyqkiaed
    qpytflyypnnhmampenlegykyhpkrdlyniekwwlak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xocA (A:)
    kpqqggdlvvgsigeptlfnslystddastdienmlysfltktdeklnvklslaesikel
    dgglaydvkikkgvkfhdgkeltaddvvftysvplskdykgergstyemlksvekkgdye
    vlfklkykdgnfynnaldstailpkhilgnvpiadleenefnrkkpigsgpfkfkewkqg
    qyikleanddyfegrpyldtvtykvipdanaaeaqlqagdinffnvpatdyktaekfnnl
    kivtdlalsyvyigwneknelfkdkkvrqalttaldresivsqvldgdgevayipespls
    wnypkdidvpkfeynekkakqmlaeagwkdtngdgildkdgkkfsftlktnqgnkvredi
    avvvqeqlkkigievktqivewsalveqmnppnwdfdamvmgwslstfpdqydifhssqi
    kkglnyvwyknaeadklmkdaksisdrkqyskeyeqiyqkiaedqpytflyypnnhmamp
    enlegykyhpkrdlyniekwwlak
    

  • Chain 'B':
    No sequence available.