Lineage for d1xmma1 (1xmm A:146-336)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2499927Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2499928Superfamily d.13.1: HIT-like [54197] (6 families) (S)
  5. 2500136Family d.13.1.3: mRNA decapping enzyme DcpS C-terminal domain [102745] (2 protein domains)
  6. 2500152Protein automated matches [254454] (1 species)
    not a true protein
  7. 2500153Species Human (Homo sapiens) [TaxId:9606] [254968] (5 PDB entries)
  8. 2500156Domain d1xmma1: 1xmm A:146-336 [122170]
    Other proteins in same PDB: d1xmma2, d1xmmb2, d1xmmc2, d1xmmd2
    automated match to d1st0a1
    complexed with g7m, m7g, po4

Details for d1xmma1

PDB Entry: 1xmm (more details), 2.5 Å

PDB Description: Structure of human Dcps bound to m7GDP
PDB Compounds: (A:) heat shock-like protein 1

SCOPe Domain Sequences for d1xmma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmma1 d.13.1.3 (A:146-336) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qdlrliretgddyrnitlphlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipd
lkwnqqqlddlyliaichrrgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrv
ylhylpsyyhlhvhftalgfeapgsgverahllaevienlecdprhyqqrtltfalradd
pllkllqeaqq

SCOPe Domain Coordinates for d1xmma1:

Click to download the PDB-style file with coordinates for d1xmma1.
(The format of our PDB-style files is described here.)

Timeline for d1xmma1: