SCOPe 2.08: Domain d1xmma1: 1xmm A:146-336

Lineage for d1xmma1 (1xmm A:146-336)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (6 families)

5. Family d.13.1.3: mRNA decapping enzyme DcpS C-terminal domain [102745] (2 proteins)

6. Protein automated matches [254454] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [254968] (5 PDB entries)

8. Domain d1xmma1: 1xmm A:146-336 [122170]
   Other proteins in same PDB: d1xmma2, d1xmmb2, d1xmmc2, d1xmmd2
   automated match to d1st0a1
   complexed with g7m, m7g, po4

Details for d1xmma1

PDB Entry: 1xmm, 2.5 Å

PDB Description: Structure of human Dcps bound to m7GDP

PDB Compounds: (A:) heat shock-like protein 1

SCOPe Domain Sequences for d1xmma1:

Sequence; same for both SEQRES and ATOM records:

>d1xmma1 d.13.1.3 (A:146-336) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qdlrliretgddyrnitlphlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipd
lkwnqqqlddlyliaichrrgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrv
ylhylpsyyhlhvhftalgfeapgsgverahllaevienlecdprhyqqrtltfalradd
pllkllqeaqq

Timeline for d1xmma1:

• d1xmma1 first appeared in SCOP 1.73
  
• d1xmma1 appears in SCOPe 2.07