PDB entry 1xmm

View 1xmm on RCSB PDB site
Description: Structure of human Dcps bound to m7GDP
Class: chaperone
Keywords: scavenger decapping enzyme bound m7GDP, CHAPERONE
Deposited on 2004-10-04, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.216
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heat shock-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAL77216
    Domains in SCOPe 2.07: d1xmma1, d1xmma2
  • Chain 'B':
    Compound: heat shock-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAL77216
    Domains in SCOPe 2.07: d1xmmb1, d1xmmb2
  • Chain 'C':
    Compound: heat shock-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAL77216
    Domains in SCOPe 2.07: d1xmmc1, d1xmmc2
  • Chain 'D':
    Compound: heat shock-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAL77216 (Start-341)
    Domains in SCOPe 2.07: d1xmmd1, d1xmmd2
  • Heterogens: PO4, M7G, G7M, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xmmA (A:)
    gplgsmadaapqlgkrkreldveeahaasteekeagvgngtcapvrlpfsgfrlqkvlre
    sardkiiflhgkvneasgdgdgedavvilektpfqveqvaqlltgspelqlqfsndiyst
    yhlfpprqlndvkttvvypatekhlqkylrqdlrliretgddyrnitlphlesqslsiqw
    vynildkkaeadrivfenpdpsdgfvlipdlkwnqqqlddlyliaichrrgirslrdltp
    ehlpllrnilhqgqeailqryrmkgdhlrvylhylpsyyhlhvhftalgfeapgsgvera
    hllaevienlecdprhyqqrtltfalraddpllkllqeaqqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmmA (A:)
    vrlpfsgfrlqkvlresardkiiflhgkvedavvilektpfqveqvaqlltgspelqlqf
    sniystyhlfpprqlndvkttvvypatekhlqkylrqdlrliretgddyrnitlphlesq
    slsiqwvynildkkaeadrivfenpdpsdgfvlipdlkwnqqqlddlyliaichrrgirs
    lrdltpehlpllrnilhqgqeailqryrmkgdhlrvylhylpsyyhlhvhftalgfeapg
    sgverahllaevienlecdprhyqqrtltfalraddpllkllqeaqq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xmmB (B:)
    gplgsmadaapqlgkrkreldveeahaasteekeagvgngtcapvrlpfsgfrlqkvlre
    sardkiiflhgkvneasgdgdgedavvilektpfqveqvaqlltgspelqlqfsndiyst
    yhlfpprqlndvkttvvypatekhlqkylrqdlrliretgddyrnitlphlesqslsiqw
    vynildkkaeadrivfenpdpsdgfvlipdlkwnqqqlddlyliaichrrgirslrdltp
    ehlpllrnilhqgqeailqryrmkgdhlrvylhylpsyyhlhvhftalgfeapgsgvera
    hllaevienlecdprhyqqrtltfalraddpllkllqeaqqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmmB (B:)
    vrlpfsgfrlqkvlresardkiiflhgkvndavvilektpfqveqvaqlltgspelqlqf
    sndiystyhlfpprqlndvkttvvypatekhlqkylrqdlrliretgddyrnitlphles
    qslsiqwvynildkkaeadrivfenpdpsdgfvlipdlkwnqqqlddlyliaichrrgir
    slrdltpehlpllrnilhqgqeailqryrmkgdhlrvylhylpsyyhlhvhftalgfeap
    gsgverahllaevienlecdprhyqqrtltfalraddpllkllqeaqq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xmmC (C:)
    gplgsmadaapqlgkrkreldveeahaasteekeagvgngtcapvrlpfsgfrlqkvlre
    sardkiiflhgkvneasgdgdgedavvilektpfqveqvaqlltgspelqlqfsndiyst
    yhlfpprqlndvkttvvypatekhlqkylrqdlrliretgddyrnitlphlesqslsiqw
    vynildkkaeadrivfenpdpsdgfvlipdlkwnqqqlddlyliaichrrgirslrdltp
    ehlpllrnilhqgqeailqryrmkgdhlrvylhylpsyyhlhvhftalgfeapgsgvera
    hllaevienlecdprhyqqrtltfalraddpllkllqeaqqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmmC (C:)
    pvrlpfsgfrlqkvlresardkiiflhgkgedavvilektpfqveqvaqlltgspelqlq
    fsndiystyhlfpprqlndvkttvvypatekhlqkylrqdlrliretgddyrnitlphle
    sqslsiqwvynildkkaeadrivfenpdpsdgfvlipdlkwnqqqlddlyliaichrrgi
    rslrdltpehlpllrnilhqgqeailqryrmkgdhlrvylhylpsyyhlhvhftalgfea
    pgsgverahllaevienlecdprhyqqrtltfalraddpllkllqeaqq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xmmD (D:)
    gplgsmadaapqlgkrkreldveeahaasteekeagvgngtcapvrlpfsgfrlqkvlre
    sardkiiflhgkvneasgdgdgedavvilektpfqveqvaqlltgspelqlqfsndiyst
    yhlfpprqlndvkttvvypatekhlqkylrqdlrliretgddyrnitlphlesqslsiqw
    vynildkkaeadrivfenpdpsdgfvlipdlkwnqqqlddlyliaichrrgirslrdltp
    ehlpllrnilhqgqeailqryrmkgdhlrvylhylpsyyhlhvhftalgfeapgsgvera
    hllaevienlecdprhyqqrtltfalraddpllkllqeaqqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmmD (D:)
    apvrlpfsgfrlqkvlresardkiiflhgkvnegdgedavvilektpfqveqvaqllpel
    qlqfsdiystyhlfpprqlndvkttvvypatekhlqkylrqdlrliretgddyrnitlph
    lesqslsiqwvynildkkaeadrivfenpdpsdgfvlipdlkwnqqqlddlyliaichrr
    girslrdltpehlpllrnilhqgqeailqryrmkgdhlrvylhylpsyyhlhvhftalgf
    eapgsgverahllaevienlecdprhyqqrtltfalraddpllkllqeaqqs