![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.246: mRNA decapping enzyme DcpS N-terminal domain [102859] (1 superfamily) beta(3)-alpha-beta(3)-alpha; 3 layers a/b/a |
![]() | Superfamily d.246.1: mRNA decapping enzyme DcpS N-terminal domain [102860] (2 families) ![]() forms swapped dimer with two 6-stranded antiparallel beta sheets; order 1236[5][4] automatically mapped to Pfam PF05652 |
![]() | Family d.246.1.0: automated matches [254206] (1 protein) not a true family |
![]() | Protein automated matches [254453] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [254967] (5 PDB entries) |
![]() | Domain d1xmmb2: 1xmm B:40-145 [122173] Other proteins in same PDB: d1xmma1, d1xmmb1, d1xmmc1, d1xmmd1 automated match to d1st0a2 complexed with g7m, m7g, po4 |
PDB Entry: 1xmm (more details), 2.5 Å
SCOPe Domain Sequences for d1xmmb2:
Sequence, based on SEQRES records: (download)
>d1xmmb2 d.246.1.0 (B:40-145) automated matches {Human (Homo sapiens) [TaxId: 9606]} vrlpfsgfrlqkvlresardkiiflhgkvneasgdgdgedavvilektpfqveqvaqllt gspelqlqfsndiystyhlfpprqlndvkttvvypatekhlqkylr
>d1xmmb2 d.246.1.0 (B:40-145) automated matches {Human (Homo sapiens) [TaxId: 9606]} vrlpfsgfrlqkvlresardkiiflhgkvndavvilektpfqveqvaqlltgspelqlqf sndiystyhlfpprqlndvkttvvypatekhlqkylr
Timeline for d1xmmb2: