Lineage for d1xmmb2 (1xmm B:40-145)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008663Fold d.246: mRNA decapping enzyme DcpS N-terminal domain [102859] (1 superfamily)
    beta(3)-alpha-beta(3)-alpha; 3 layers a/b/a
  4. 3008664Superfamily d.246.1: mRNA decapping enzyme DcpS N-terminal domain [102860] (2 families) (S)
    forms swapped dimer with two 6-stranded antiparallel beta sheets; order 1236[5][4]
    automatically mapped to Pfam PF05652
  5. 3008681Family d.246.1.0: automated matches [254206] (1 protein)
    not a true family
  6. 3008682Protein automated matches [254453] (1 species)
    not a true protein
  7. 3008683Species Human (Homo sapiens) [TaxId:9606] [254967] (5 PDB entries)
  8. 3008689Domain d1xmmb2: 1xmm B:40-145 [122173]
    Other proteins in same PDB: d1xmma1, d1xmmb1, d1xmmc1, d1xmmd1
    automated match to d1st0a2
    complexed with g7m, m7g, po4

Details for d1xmmb2

PDB Entry: 1xmm (more details), 2.5 Å

PDB Description: Structure of human Dcps bound to m7GDP
PDB Compounds: (B:) heat shock-like protein 1

SCOPe Domain Sequences for d1xmmb2:

Sequence, based on SEQRES records: (download)

>d1xmmb2 d.246.1.0 (B:40-145) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vrlpfsgfrlqkvlresardkiiflhgkvneasgdgdgedavvilektpfqveqvaqllt
gspelqlqfsndiystyhlfpprqlndvkttvvypatekhlqkylr

Sequence, based on observed residues (ATOM records): (download)

>d1xmmb2 d.246.1.0 (B:40-145) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vrlpfsgfrlqkvlresardkiiflhgkvndavvilektpfqveqvaqlltgspelqlqf
sndiystyhlfpprqlndvkttvvypatekhlqkylr

SCOPe Domain Coordinates for d1xmmb2:

Click to download the PDB-style file with coordinates for d1xmmb2.
(The format of our PDB-style files is described here.)

Timeline for d1xmmb2: