Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
Superfamily d.13.1: HIT-like [54197] (6 families) |
Family d.13.1.3: mRNA decapping enzyme DcpS C-terminal domain [102745] (2 proteins) |
Protein automated matches [254454] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [254968] (5 PDB entries) |
Domain d1xmmc1: 1xmm C:146-336 [122174] Other proteins in same PDB: d1xmma2, d1xmmb2, d1xmmc2, d1xmmd2 automated match to d1st0a1 complexed with g7m, m7g, po4 |
PDB Entry: 1xmm (more details), 2.5 Å
SCOPe Domain Sequences for d1xmmc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xmmc1 d.13.1.3 (C:146-336) automated matches {Human (Homo sapiens) [TaxId: 9606]} qdlrliretgddyrnitlphlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipd lkwnqqqlddlyliaichrrgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrv ylhylpsyyhlhvhftalgfeapgsgverahllaevienlecdprhyqqrtltfalradd pllkllqeaqq
Timeline for d1xmmc1: