SCOPe 2.07: Domain d1xmlb2: 1xml B:40-145

Lineage for d1xmlb2 (1xml B:40-145)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.246: mRNA decapping enzyme DcpS N-terminal domain [102859] (1 superfamily)
   beta(3)-alpha-beta(3)-alpha; 3 layers a/b/a

4. Superfamily d.246.1: mRNA decapping enzyme DcpS N-terminal domain [102860] (2 families)
   forms swapped dimer with two 6-stranded antiparallel beta sheets; order 1236[5][4]
   automatically mapped to Pfam PF05652

5. Family d.246.1.0: automated matches [254206] (1 protein)
   not a true family

6. Protein automated matches [254453] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [254967] (5 PDB entries)

8. Domain d1xmlb2: 1xml B:40-145 [122169]
   Other proteins in same PDB: d1xmla1, d1xmlb1
   automated match to d1st0a2
   complexed with po4

Details for d1xmlb2

PDB Entry: 1xml, 2 Å

PDB Description: structure of human dcps

PDB Compounds: (B:) heat shock-like protein 1

SCOPe Domain Sequences for d1xmlb2:

Sequence, based on SEQRES records:

>d1xmlb2 d.246.1.0 (B:40-145) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vrlpfsgfrlqkvlresardkiiflhgkvneasgdgdgedavvilektpfqveqvaqllt
gspelqlqfsndiystyhlfpprqlndvkttvvypatekhlqkylr

Sequence, based on observed residues (ATOM records):

>d1xmlb2 d.246.1.0 (B:40-145) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vrlpfsgfrlqkvlresardkiiflhgkvnedavvilektpfqveqvaqlltgspelqlq
fsndiystyhlfpprqlndvkttvvypatekhlqkylr

Timeline for d1xmlb2:

• d1xmlb2 first appeared in SCOP 1.73
  
• d1xmlb2 appears in SCOPe 2.06
  
• d1xmlb2 appears in the current release, SCOPe 2.08