Lineage for d1xmla2 (1xml A:38-145)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2614505Fold d.246: mRNA decapping enzyme DcpS N-terminal domain [102859] (1 superfamily)
    beta(3)-alpha-beta(3)-alpha; 3 layers a/b/a
  4. 2614506Superfamily d.246.1: mRNA decapping enzyme DcpS N-terminal domain [102860] (2 families) (S)
    forms swapped dimer with two 6-stranded antiparallel beta sheets; order 1236[5][4]
    automatically mapped to Pfam PF05652
  5. 2614523Family d.246.1.0: automated matches [254206] (1 protein)
    not a true family
  6. 2614524Protein automated matches [254453] (1 species)
    not a true protein
  7. 2614525Species Human (Homo sapiens) [TaxId:9606] [254967] (5 PDB entries)
  8. 2614526Domain d1xmla2: 1xml A:38-145 [122167]
    Other proteins in same PDB: d1xmla1, d1xmlb1
    automated match to d1st0a2
    complexed with po4

Details for d1xmla2

PDB Entry: 1xml (more details), 2 Å

PDB Description: structure of human dcps
PDB Compounds: (A:) heat shock-like protein 1

SCOPe Domain Sequences for d1xmla2:

Sequence, based on SEQRES records: (download)

>d1xmla2 d.246.1.0 (A:38-145) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apvrlpfsgfrlqkvlresardkiiflhgkvneasgdgdgedavvilektpfqveqvaql
ltgspelqlqfsndiystyhlfpprqlndvkttvvypatekhlqkylr

Sequence, based on observed residues (ATOM records): (download)

>d1xmla2 d.246.1.0 (A:38-145) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apvrlpfsgfrlqkvlresardkiiflhgkvneedavvilektpfqveqvaqlltgspel
qlqfsndiystyhlfpprqlndvkttvvypatekhlqkylr

SCOPe Domain Coordinates for d1xmla2:

Click to download the PDB-style file with coordinates for d1xmla2.
(The format of our PDB-style files is described here.)

Timeline for d1xmla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xmla1