![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.246: mRNA decapping enzyme DcpS N-terminal domain [102859] (1 superfamily) beta(3)-alpha-beta(3)-alpha; 3 layers a/b/a |
![]() | Superfamily d.246.1: mRNA decapping enzyme DcpS N-terminal domain [102860] (1 family) ![]() forms swapped dimer with two 6-stranded antiparallel beta sheets; order 1236[5][4] |
![]() | Family d.246.1.1: mRNA decapping enzyme DcpS N-terminal domain [102861] (1 protein) |
![]() | Protein mRNA decapping enzyme DcpS N-terminal domain [102862] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102863] (4 PDB entries) |
![]() | Domain d1xmlb2: 1xml B:40-145 [122169] Other proteins in same PDB: d1xmla1, d1xmlb1 automatically matched to d1st0a2 complexed with po4; mutant |
PDB Entry: 1xml (more details), 2 Å
SCOP Domain Sequences for d1xmlb2:
Sequence, based on SEQRES records: (download)
>d1xmlb2 d.246.1.1 (B:40-145) mRNA decapping enzyme DcpS N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} vrlpfsgfrlqkvlresardkiiflhgkvneasgdgdgedavvilektpfqveqvaqllt gspelqlqfsndiystyhlfpprqlndvkttvvypatekhlqkylr
>d1xmlb2 d.246.1.1 (B:40-145) mRNA decapping enzyme DcpS N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} vrlpfsgfrlqkvlresardkiiflhgkvnedavvilektpfqveqvaqlltgspelqlq fsndiystyhlfpprqlndvkttvvypatekhlqkylr
Timeline for d1xmlb2: