Lineage for d1xjba_ (1xjb A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1144933Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 1144934Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 1144954Protein 3-alpha-hydroxysteroid dehydrogenase [51439] (2 species)
  7. 1144955Species Human (Homo sapiens), type III [TaxId:9606] [69383] (5 PDB entries)
    bile acid binding protein
  8. 1144960Domain d1xjba_: 1xjb A: [122032]
    automated match to d1j96a_
    complexed with act, bme, cit, edo, nap, so4

Details for d1xjba_

PDB Entry: 1xjb (more details), 1.9 Å

PDB Description: crystal structure of human type 3 3alpha-hydroxysteroid dehydrogenase in complex with nadp(h), citrate and acetate molecules
PDB Compounds: (A:) Aldo-keto reductase family 1 member C2

SCOPe Domain Sequences for d1xjba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xjba_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Human (Homo sapiens), type III [TaxId: 9606]}
svddskyqcvklndghfmpvlgfgtyapaevpkskaleavklaieagfhhidsahvynne
eqvglairskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihf
pvsvkpgeevipkdengkilfdtvdlcatweamekckdaglaksigvsnfnhrllemiln
kpglkykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlled
pvlcalakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidg
lnrnvryltldifagppnypfsdey

SCOPe Domain Coordinates for d1xjba_:

Click to download the PDB-style file with coordinates for d1xjba_.
(The format of our PDB-style files is described here.)

Timeline for d1xjba_: