Lineage for d1xjba2 (1xjb A:2-323)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829136Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2829137Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2829157Protein 3-alpha-hydroxysteroid dehydrogenase [51439] (2 species)
  7. 2829158Species Human (Homo sapiens), type III [TaxId:9606] [69383] (16 PDB entries)
    bile acid binding protein
  8. 2829187Domain d1xjba2: 1xjb A:2-323 [122032]
    Other proteins in same PDB: d1xjba3
    automated match to d1j96a_
    complexed with act, bme, cit, edo, nap, so4

Details for d1xjba2

PDB Entry: 1xjb (more details), 1.9 Å

PDB Description: crystal structure of human type 3 3alpha-hydroxysteroid dehydrogenase in complex with nadp(h), citrate and acetate molecules
PDB Compounds: (A:) Aldo-keto reductase family 1 member C2

SCOPe Domain Sequences for d1xjba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xjba2 c.1.7.1 (A:2-323) 3-alpha-hydroxysteroid dehydrogenase {Human (Homo sapiens), type III [TaxId: 9606]}
dskyqcvklndghfmpvlgfgtyapaevpkskaleavklaieagfhhidsahvynneeqv
glairskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihfpvs
vkpgeevipkdengkilfdtvdlcatweamekckdaglaksigvsnfnhrllemilnkpg
lkykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpvl
calakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidglnr
nvryltldifagppnypfsdey

SCOPe Domain Coordinates for d1xjba2:

Click to download the PDB-style file with coordinates for d1xjba2.
(The format of our PDB-style files is described here.)

Timeline for d1xjba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xjba3
View in 3D
Domains from other chains:
(mouse over for more information)
d1xjbb_