Lineage for d1xh1a1 (1xh1 A:409-496)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. Protein automated matches [226835] (41 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [225771] (22 PDB entries)
  8. Domain d1xh1a1: 1xh1 A:409-496 [121991]
    Other proteins in same PDB: d1xh1a2
    automated match to d1jxka1
    complexed with ca, cl, nag

Details for d1xh1a1

PDB Entry: 1xh1 (more details), 2.03 Å

PDB Description: structure of the n298s variant of human pancreatic alpha-amylase complexed with chloride
PDB Compounds: (A:) alpha-amylase, pancreatic

SCOPe Domain Sequences for d1xh1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xh1a1 b.71.1.0 (A:409-496) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnctgikiy
vsddgkahfsisnsaedpfiaihaeskl

SCOPe Domain Coordinates for d1xh1a1 are not available.

Timeline for d1xh1a1:

Domains from same chain:
(mouse over for more information)
d1xh1a2