SCOPe 2.08: Domain d1xh1a2: 1xh1 A:1-408

Lineage for d1xh1a2 (1xh1 A:1-408)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein automated matches [190099] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225770] (14 PDB entries)

8. Domain d1xh1a2: 1xh1 A:1-408 [121992]
   Other proteins in same PDB: d1xh1a1
   automated match to d1jxka2
   complexed with ca, cl, nag

Details for d1xh1a2

PDB Entry: 1xh1, 2.03 Å

PDB Description: structure of the n298s variant of human pancreatic alpha-amylase complexed with chloride

PDB Compounds: (A:) alpha-amylase, pancreatic

SCOPe Domain Sequences for d1xh1a2:

Sequence; same for both SEQRES and ATOM records:

>d1xh1a2 c.1.8.1 (A:1-408) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eyspntqqgrtsivhlfewrwvdialecerylapkgfggvqvsppnenvaiynpfrpwwe
ryqpvsyklctrsgnedefrnmvtrcnnvgvriyvdavinhmcgnavsagtsstcgsyfn
pgsrdfpavpysgwdfndgkcktgsgdienyndatqvrdcrltglldlalekdyvrskia
eymnhlidigvagfrldaskhmwpgdikaildklhnlnsnwfpagskpfiyqevidlgge
pikssdyfgngrvtefkygaklgtvirkwngekmsylknwgegwgfvpsdralvfvdshd
nqrghgaggasiltfwdarlykmavgfmlahpygftrvmssyrwprqfqngndvndwvgp
pnnngvikevtinpdttcgndwvcehrwrqirnmvifrnvvdgqpftn

Timeline for d1xh1a2:

• d1xh1a2 first appeared in SCOP 1.73
  
• d1xh1a2 appears in SCOPe 2.07