Lineage for d1xh1a2 (1xh1 A:1-408)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. Protein automated matches [190099] (31 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [225770] (14 PDB entries)
  8. Domain d1xh1a2: 1xh1 A:1-408 [121992]
    Other proteins in same PDB: d1xh1a1
    automated match to d1jxka2
    complexed with ca, cl, nag

Details for d1xh1a2

PDB Entry: 1xh1 (more details), 2.03 Å

PDB Description: structure of the n298s variant of human pancreatic alpha-amylase complexed with chloride
PDB Compounds: (A:) alpha-amylase, pancreatic

SCOPe Domain Sequences for d1xh1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xh1a2 c.1.8.1 (A:1-408) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eyspntqqgrtsivhlfewrwvdialecerylapkgfggvqvsppnenvaiynpfrpwwe
ryqpvsyklctrsgnedefrnmvtrcnnvgvriyvdavinhmcgnavsagtsstcgsyfn
pgsrdfpavpysgwdfndgkcktgsgdienyndatqvrdcrltglldlalekdyvrskia
eymnhlidigvagfrldaskhmwpgdikaildklhnlnsnwfpagskpfiyqevidlgge
pikssdyfgngrvtefkygaklgtvirkwngekmsylknwgegwgfvpsdralvfvdshd
nqrghgaggasiltfwdarlykmavgfmlahpygftrvmssyrwprqfqngndvndwvgp
pnnngvikevtinpdttcgndwvcehrwrqirnmvifrnvvdgqpftn

SCOPe Domain Coordinates for d1xh1a2 are not available.

Timeline for d1xh1a2:

Domains from same chain:
(mouse over for more information)
d1xh1a1