SCOPe 2.07: Domain d1xh1a1: 1xh1 A:409-496

Lineage for d1xh1a1 (1xh1 A:409-496)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (41 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225771] (22 PDB entries)

8. Domain d1xh1a1: 1xh1 A:409-496 [121991]
   Other proteins in same PDB: d1xh1a2
   automated match to d1jxka1
   complexed with ca, cl, nag

Details for d1xh1a1

PDB Entry: 1xh1, 2.03 Å

PDB Description: structure of the n298s variant of human pancreatic alpha-amylase complexed with chloride

PDB Compounds: (A:) alpha-amylase, pancreatic

SCOPe Domain Sequences for d1xh1a1:

Sequence; same for both SEQRES and ATOM records:

>d1xh1a1 b.71.1.0 (A:409-496) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnctgikiy
vsddgkahfsisnsaedpfiaihaeskl

Timeline for d1xh1a1:

• d1xh1a1 first appeared in SCOP 1.73
  
• d1xh1a1 appears in SCOPe 2.06
  
• d1xh1a1 appears in the current release, SCOPe 2.08