SCOPe 2.07: Domain d1xbxb_: 1xbx B:

Lineage for d1xbxb_ (1xbx B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.3: Decarboxylase [51375] (4 proteins)

6. Protein automated matches [190130] (11 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [186853] (1 PDB entry)

8. Domain d1xbxb_: 1xbx B: [121845]
   Other proteins in same PDB: d1xbxa1
   automated match to d1kv8b_
   complexed with 5rp, hms, mg; mutant

Details for d1xbxb_

PDB Entry: 1xbx, 1.81 Å

PDB Description: Structure of 3-keto-L-gulonate 6-phosphate decarboxylase E112D/R139V/T169A mutant with bound D-ribulose 5-phosphate

PDB Compounds: (B:) 3-Keto-L-Gulonate 6-Phosphate Decarboxylase

SCOPe Domain Sequences for d1xbxb_:

Sequence; same for both SEQRES and ATOM records:

>d1xbxb_ c.1.2.3 (B:) automated matches {Escherichia coli [TaxId: 562]}
slpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivla
dakiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqidltgywtweq
aqqwrdagigqvvyhrsvdaqaagvawgeaditaikrlsdmgfkvtvagglaledlplfk
gipihvfiagrsirdaaspveaarqfkrsiaelwg

Timeline for d1xbxb_:

• d1xbxb_ first appeared in SCOP 1.73, called d1xbxb1
  
• d1xbxb_ appears in SCOPe 2.06
  
• d1xbxb_ appears in the current release, SCOPe 2.08