Lineage for d1xbxb1 (1xbx B:3-215)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 681300Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families) (S)
  5. 681364Family c.1.2.3: Decarboxylase [51375] (3 proteins)
  6. 681365Protein 3-keto-L-gulonate 6-phosphate decarboxylase [75050] (1 species)
  7. 681366Species Escherichia coli [TaxId:562] [75051] (14 PDB entries)
  8. 681380Domain d1xbxb1: 1xbx B:3-215 [121845]
    automatically matched to 1XBX A:3-215
    complexed with 5rp, mg; mutant

Details for d1xbxb1

PDB Entry: 1xbx (more details), 1.81 Å

PDB Description: Structure of 3-keto-L-gulonate 6-phosphate decarboxylase E112D/R139V/T169A mutant with bound D-ribulose 5-phosphate
PDB Compounds: (B:) 3-Keto-L-Gulonate 6-Phosphate Decarboxylase

SCOP Domain Sequences for d1xbxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xbxb1 c.1.2.3 (B:3-215) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]}
lpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivlad
akiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqidltgywtweqa
qqwrdagigqvvyhrsvdaqaagvawgeaditaikrlsdmgfkvtvagglaledlplfkg
ipihvfiagrsirdaaspveaarqfkrsiaelw

SCOP Domain Coordinates for d1xbxb1:

Click to download the PDB-style file with coordinates for d1xbxb1.
(The format of our PDB-style files is described here.)

Timeline for d1xbxb1: