![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) ![]() |
![]() | Family c.1.2.3: Decarboxylase [51375] (4 proteins) |
![]() | Protein automated matches [190130] (11 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [186853] (1 PDB entry) |
![]() | Domain d1xbxb_: 1xbx B: [121845] Other proteins in same PDB: d1xbxa1 automated match to d1kv8b_ complexed with 5rp, hms, mg; mutant |
PDB Entry: 1xbx (more details), 1.81 Å
SCOPe Domain Sequences for d1xbxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xbxb_ c.1.2.3 (B:) automated matches {Escherichia coli [TaxId: 562]} slpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivla dakiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqidltgywtweq aqqwrdagigqvvyhrsvdaqaagvawgeaditaikrlsdmgfkvtvagglaledlplfk gipihvfiagrsirdaaspveaarqfkrsiaelwg
Timeline for d1xbxb_: