| Class j: Peptides [58231] (151 folds) |
| Fold j.11: VPR protein fragments [58353] (1 superfamily) |
Superfamily j.11.1: VPR protein fragments [58354] (1 family) ![]() |
| Family j.11.1.1: VPR protein fragments [58355] (1 protein) |
| Protein VPR protein fragments [58356] (1 species) |
| Species Human immunodeficiency virus type 1 [TaxId:11676] [58357] (12 PDB entries) |
| Domain d1x9vb1: 1x9v B:52-96 [121828] automatically matched to 1X9V A:52-96 |
PDB Entry: 1x9v (more details)
SCOPe Domain Sequences for d1x9vb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x9vb1 j.11.1.1 (B:52-96) VPR protein fragments {Human immunodeficiency virus type 1 [TaxId: 11676]}
dtwtgvealirilqqllfihfrigcrhsrigiiqqrrtrngasks
Timeline for d1x9vb1: