PDB entry 1x9v

View 1x9v on RCSB PDB site
Description: Dimeric structure of the C-terminal domain of Vpr
Class: Viral protein
Keywords: alpha helix, antiparallel homodimer, leucine-zipper, Viral protein
Deposited on 2004-08-24, released 2005-06-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vpr protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1x9va1
  • Chain 'B':
    Compound: vpr protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1x9vb1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x9vA (A:)
    dtwtgvealirilqqllfihfrigcrhsrigiiqqrrtrngasks
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x9vB (B:)
    dtwtgvealirilqqllfihfrigcrhsrigiiqqrrtrngasks