Lineage for d1x9va1 (1x9v A:52-96)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3046135Fold j.11: VPR protein fragments [58353] (1 superfamily)
  4. 3046136Superfamily j.11.1: VPR protein fragments [58354] (1 family) (S)
  5. 3046137Family j.11.1.1: VPR protein fragments [58355] (1 protein)
  6. 3046138Protein VPR protein fragments [58356] (1 species)
  7. 3046139Species Human immunodeficiency virus type 1 [TaxId:11676] [58357] (12 PDB entries)
  8. 3046151Domain d1x9va1: 1x9v A:52-96 [121827]

Details for d1x9va1

PDB Entry: 1x9v (more details)

PDB Description: dimeric structure of the c-terminal domain of vpr
PDB Compounds: (A:) vpr protein

SCOPe Domain Sequences for d1x9va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x9va1 j.11.1.1 (A:52-96) VPR protein fragments {Human immunodeficiency virus type 1 [TaxId: 11676]}
dtwtgvealirilqqllfihfrigcrhsrigiiqqrrtrngasks

SCOPe Domain Coordinates for d1x9va1:

Click to download the PDB-style file with coordinates for d1x9va1.
(The format of our PDB-style files is described here.)

Timeline for d1x9va1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1x9vb1