SCOPe 2.02: Domain d1x64a1: 1x64 A:8-52

Lineage for d1x64a1 (1x64 A:8-52)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.3: LIM domain [57736] (18 proteins)
   duplication: contains two (sub)domains of this fold

6. Protein PDZ and LIM domain protein 3, PDLIM3 [144185] (1 species)
   Alpha-actinin-2-associated LIM protein

7. Species Mouse (Mus musculus) [TaxId:10090] [144186] (1 PDB entry)
   Uniprot O70209 270-301! Uniprot O70209 271-301

8. Domain d1x64a1: 1x64 A:8-52 [121733]
   complexed with zn

Details for d1x64a1

PDB Entry: 1x64

PDB Description: solution structure of the lim domain of alpha-actinin-2 associated lim protein

PDB Compounds: (A:) Alpha-actinin-2 associated LIM protein

SCOPe Domain Sequences for d1x64a1:

Sequence; same for both SEQRES and ATOM records:

>d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]}
vrapvtkvhggagsaqrmplcdkcgsgivgavvkardkyrhpecf

Timeline for d1x64a1:

• d1x64a1 first appeared in SCOP 1.73
  
• d1x64a1 appears in SCOPe 2.01
  
• d1x64a1 appears in SCOPe 2.03
  
• d1x64a1 appears in the current release, SCOPe 2.08