Lineage for d1x64a1 (1x64 A:8-52)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3035744Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. 3035833Protein PDZ and LIM domain protein 3, PDLIM3 [144185] (1 species)
    Alpha-actinin-2-associated LIM protein
  7. 3035834Species Mouse (Mus musculus) [TaxId:10090] [144186] (1 PDB entry)
    Uniprot O70209 270-301! Uniprot O70209 271-301
  8. 3035835Domain d1x64a1: 1x64 A:8-52 [121733]
    Other proteins in same PDB: d1x64a3, d1x64a4
    complexed with zn

Details for d1x64a1

PDB Entry: 1x64 (more details)

PDB Description: solution structure of the lim domain of alpha-actinin-2 associated lim protein
PDB Compounds: (A:) Alpha-actinin-2 associated LIM protein

SCOPe Domain Sequences for d1x64a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]}
vrapvtkvhggagsaqrmplcdkcgsgivgavvkardkyrhpecf

SCOPe Domain Coordinates for d1x64a1:

Click to download the PDB-style file with coordinates for d1x64a1.
(The format of our PDB-style files is described here.)

Timeline for d1x64a1: