![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) ![]() |
![]() | Family g.39.1.3: LIM domain [57736] (18 proteins) duplication: contains two (sub)domains of this fold |
![]() | Protein PDZ and LIM domain protein 3, PDLIM3 [144185] (1 species) Alpha-actinin-2-associated LIM protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [144186] (1 PDB entry) Uniprot O70209 270-301! Uniprot O70209 271-301 |
![]() | Domain d1x64a1: 1x64 A:8-52 [121733] Other proteins in same PDB: d1x64a3, d1x64a4 complexed with zn |
PDB Entry: 1x64 (more details)
SCOPe Domain Sequences for d1x64a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} vrapvtkvhggagsaqrmplcdkcgsgivgavvkardkyrhpecf
Timeline for d1x64a1: