Lineage for d1x45a1 (1x45 A:8-92)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1122537Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1122538Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1122539Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 1122548Protein Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) [141282] (1 species)
  7. 1122549Species Human (Homo sapiens) [TaxId:9606] [141283] (6 PDB entries)
    Uniprot Q02410 656-740! Uniprot Q02410 657-743! Uniprot Q02410 657-745! Uniprot Q02410 743-822! Uniprot Q02410 745-823! Uniprot Q02410 746-839
    structure of the PTB domain is also known (50757)
  8. 1122551Domain d1x45a1: 1x45 A:8-92 [121679]
    1st PDZ domain

Details for d1x45a1

PDB Entry: 1x45 (more details)

PDB Description: solution structure of the first pdz domain of amyloid beta a4 precursor protein-binding family a, member 1
PDB Compounds: (A:) amyloid beta (A4) precursor protein-binding, family A, member 1 (X11)

SCOPe Domain Sequences for d1x45a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]}
dvfiekqkgeilgvvivesgwgsilptviianmmhggpaeksgklnigdqimsingtslv
glplstcqsiikglknqsrvklniv

SCOPe Domain Coordinates for d1x45a1:

Click to download the PDB-style file with coordinates for d1x45a1.
(The format of our PDB-style files is described here.)

Timeline for d1x45a1: