SCOP 1.73: Domain d1x45a1: 1x45 A:8-92

Lineage for d1x45a1 (1x45 A:8-92)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (4 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (46 proteins)
   Pfam PF00595

6. Protein Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) [141282] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141283] (6 PDB entries)
   structure of the PTB domain is also known (scop_sp 50757)

8. Domain d1x45a1: 1x45 A:8-92 [121679]
   1st PDZ domain

Details for d1x45a1

PDB Entry: 1x45

PDB Description: solution structure of the first pdz domain of amyloid beta a4 precursor protein-binding family a, member 1

PDB Compounds: (A:) amyloid beta (A4) precursor protein-binding, family A, member 1 (X11)

SCOP Domain Sequences for d1x45a1:

Sequence; same for both SEQRES and ATOM records:

>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]}
dvfiekqkgeilgvvivesgwgsilptviianmmhggpaeksgklnigdqimsingtslv
glplstcqsiikglknqsrvklniv

Timeline for d1x45a1:

• d1x45a1 is new in SCOP 1.73
  
• d1x45a1 appears in SCOP 1.75
  
• d1x45a1 appears in the current release, SCOPe 2.08