Lineage for d1x45a1 (1x45 A:8-92)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 666573Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 666574Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 666575Family b.36.1.1: PDZ domain [50157] (46 proteins)
    Pfam PF00595
  6. 666584Protein Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) [141282] (1 species)
  7. 666585Species Human (Homo sapiens) [TaxId:9606] [141283] (6 PDB entries)
    structure of the PTB domain is also known (scop_sp 50757)
  8. 666589Domain d1x45a1: 1x45 A:8-92 [121679]
    1st PDZ domain

Details for d1x45a1

PDB Entry: 1x45 (more details)

PDB Description: Solution structure of the first PDZ domain of amyloid beta A4 precursor protein-binding family A, member 1
PDB Compounds: (A:) amyloid beta (A4) precursor protein-binding, family A, member 1 (X11)

SCOP Domain Sequences for d1x45a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]}
dvfiekqkgeilgvvivesgwgsilptviianmmhggpaeksgklnigdqimsingtslv
glplstcqsiikglknqsrvklniv

SCOP Domain Coordinates for d1x45a1:

Click to download the PDB-style file with coordinates for d1x45a1.
(The format of our PDB-style files is described here.)

Timeline for d1x45a1: