SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1x45a1 (1x45 A:8-92)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2048292Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2048293Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2048294Family b.36.1.1: PDZ domain [50157] (47 protein domains)
    Pfam PF00595
  6. 2048302Protein Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) [141282] (1 species)
  7. 2048303Species Human (Homo sapiens) [TaxId:9606] [141283] (6 PDB entries)
    Uniprot Q02410 656-740! Uniprot Q02410 657-743! Uniprot Q02410 657-745! Uniprot Q02410 743-822! Uniprot Q02410 745-823! Uniprot Q02410 746-839
    structure of the PTB domain is also known (50757)
  8. 2048305Domain d1x45a1: 1x45 A:8-92 [121679]
    Other proteins in same PDB: d1x45a2, d1x45a3
    1st PDZ domain

Details for d1x45a1

PDB Entry: 1x45 (more details)

PDB Description: Solution structure of the first PDZ domain of amyloid beta A4 precursor protein-binding family A, member 1
PDB Compounds: (A:) amyloid beta (A4) precursor protein-binding, family A, member 1 (X11)

SCOPe Domain Sequences for d1x45a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]}
dvfiekqkgeilgvvivesgwgsilptviianmmhggpaeksgklnigdqimsingtslv
glplstcqsiikglknqsrvklniv

SCOPe Domain Coordinates for d1x45a1:

Click to download the PDB-style file with coordinates for d1x45a1.
(The format of our PDB-style files is described here.)

Timeline for d1x45a1: